The Rb_C domain within your query sequence starts at position 761 and ends at position 920, and its E-value is 1.28e-96.

ILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGADEADGSKHLPAESKFQQKLAEMTSTRTRMQKQRMNESKDVSNKEE
Rb_C

Rb_C

Rb C-terminal domain
SMART ACC:SM001369
Description:The Rb C-terminal domain is required for high-affinity binding to E2F-DP complexes and for maximal repression of E2F-responsive promoters, thereby acting as a growth suppressor by blocking the G1-S transition of the cell cycle. This domain has a strand-loop-helix structure, which directly interacts with both E2F1 and DP1, followed by a tail segment that lacks regular secondary structure (PMID:16360038).
InterPro ACC:IPR015030
InterPro abstract:

The RB C-terminal domain is required for high-affinity binding to E2F-DP complexes and for maximal repression of E2F-responsive promoters, thereby acting as a growth suppressor by blocking the G1-S transition of the cell cycle. This domain has a strand-loop-helix structure, which directly interacts with both E2F1 and DP1, followed by a tail segment that lacks regular secondary structure [ expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 145 Rb_C domains in 1 145 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Rb_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Rb_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Rb_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Rb_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Rb_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Links to other resources describing this domain

InterProIPR015030
PfamRb_C