The Beta-Casp domain within your query sequence starts at position 334 and ends at position 462, and its E-value is 7.65e-16.

IYDLLECLYQYIDSAGLSNIPFYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYRSIHGDFSNDFRQPCVLFTGHPSLRFGDVVHFMELWGKSSLNTIIFTEPDFSYLEAL
Beta-Casp

Beta-Casp

Beta-Casp domain
SMART ACC:SM001027
Description:The beta-CASP domain is found C terminal to the beta-lactamase domain in pre-mRNA 3'-end-processing endonuclease. The active site of this enzyme is located at the interface of these two domains.
InterPro ACC:IPR022712
InterPro abstract:

The beta-CASP domain is found C-terminal to the beta-lactamase domain in pre-mRNA 3'-end-processing endonuclease. The active site of this enzyme is located at the interface of these two domains [ PUBMED:17128255 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 15 486 Beta-Casp domains in 15 481 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Beta-Casp domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Beta-Casp domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Beta-Casp domain which could be assigned to a KEGG orthologous group, and not all proteins containing Beta-Casp domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamBeta-Casp
InterProIPR022712