The WD40 domain within your query sequence starts at position 142 and ends at position 180, and its E-value is 3.55e-5.

KDSFLYSLPHRHPVNAACFSPDGARLLTTDQNNEIRVYS
WD40

WD40

WD40 repeats
SMART ACC:SM000320
Description:Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.
InterPro ACC:IPR001680
InterPro abstract:

WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed β-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised β-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 918 936 WD40 domains in 345 139 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing WD40 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing WD40 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the WD40 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the WD40 domain.

ProteinDescriptionDisease / phenotype
PEX7_HUMANOMIM:601757 : Rhizomelic chondrodysplasia punctata, type 1
OMIM:215100 : no description
LIS1_HUMANOMIM:601545 : Lissencephaly-1 ; Subcortical laminar heterotopia
OMIM:247200 : Miller-Dieker lissencephaly syndrome
DDB2_HUMANOMIM:600811 : Xeroderma pigmentosum, group E, DDB-negative subtype
OMIM:278740 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a WD40 domain which could be assigned to a KEGG orthologous group, and not all proteins containing WD40 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEWD_REPEATS
InterProIPR001680
PfamWD40