The IL7 domain within your query sequence starts at position 27 and ends at position 152, and its E-value is 2.78e-86.

KHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
IL7

IL7

Interleukin-7 and interleukin-9 family.
SMART ACC:SM000127
Description:IL-7 is a cytokine that acts as a growth factor for early lymphoid cells of both B- and T-cell lineages. IL-9 is a multifunctional cytokine that, although originally described as a T-cell growth factor, its function in T-cell response remains unclear.
InterPro ACC:IPR001181
InterPro abstract:

This entry represents interleukin-7 (IL7), it is a hematopoietic growth factor produced by bone marrow stromal cells. It promotes growth of B- and T-cell precursors and functions with IL2 in the activation of mature T-cells [ PUBMED:2643102 PUBMED:3259677 expand

GO process:immune response (GO:0006955)
GO component:extracellular region (GO:0005576)
GO function:interleukin-7 receptor binding (GO:0005139), growth factor activity (GO:0008083)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 56 IL7 domains in 56 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IL7 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IL7 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the IL7 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IL7 domain which could be assigned to a KEGG orthologous group, and not all proteins containing IL7 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEIL7_DOMAIN
InterProIPR001181