The H2B domain within your query sequence starts at position 28 and ends at position 124, and its E-value is 1.43e-72.

KKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
H2B

H2B

Histone H2B
SMART ACC:SM000427
Description: -
InterPro ACC:IPR000558
InterPro abstract:

Histone H2B is one of the five histones, along with H1/H5, H2A, H3 and H4. Two copies of each of the H2A, H2B, H3, and H4 histones ensemble to form the core of the nucleosome [ PUBMED:16472024 ]. The nucleosome forms octameric structure that wraps DNA in a left-handed manner. Histones can undergo several different types … expand

GO component:nucleosome (GO:0000786)
GO function:DNA binding (GO:0003677), structural constituent of chromatin (GO:0030527)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 436 H2B domains in 5 379 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing H2B domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing H2B domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the H2B domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a H2B domain which could be assigned to a KEGG orthologous group, and not all proteins containing H2B domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamhistone
InterProIPR000558
PROSITEHISTONE_H2B