The alkPPc domain within your query sequence starts at position 54 and ends at position 489, and its E-value is 7.97e-247.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 99185045 ) for details.

KNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQASQDPAVTHLMGLFEPTEMKYDANRNPSVDPSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGLAPLKALDDKSYTSILYGNGPGYELKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLE
alkPPc

alkPPc

Alkaline phosphatase homologues
SMART ACC:SM000098
Description: -
InterPro ACC:IPR001952
InterPro abstract:

This entry represents alkaline phosphatases ( EC:3.1.3.1 ) (ALP), which act as non-specific phosphomonoesterases to hydrolyse phosphate esters, optimally at high pH. The reaction mechanism involves the attack of a serine alkoxide on a phosphorus of the substrate to form a transient covalent enzyme-phosphate complex, followed by … expand

GO function:phosphatase activity (GO:0016791)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 11 753 alkPPc domains in 11 636 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing alkPPc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing alkPPc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the alkPPc domain.

ProteinDescriptionDisease / phenotype
PPBT_HUMANOMIM:171760 : Hypophosphatasia, infantile
OMIM:241500 : Hypophosphatasia, childhood
OMIM:241510 : ?Hypophosphatasia, adult
OMIM:146300 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a alkPPc domain which could be assigned to a KEGG orthologous group, and not all proteins containing alkPPc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001952