The DSS1_SEM1 domain within your query sequence starts at position 5 and ends at position 62, and its E-value is 1.43e-26.

KQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEK
DSS1_SEM1

DSS1_SEM1

SMART ACC:SM001385
Description:This family contains the breast cancer tumour suppressor BRCA2-interacting protein DSS1 and its homologue SEM1, both of which are short acidic proteins. DSS1 has been shown to be a conserved component of the Rae1 mediated mRNA export pathway in Schizosaccharomyces pombe (PMID:15990877).
InterPro ACC:IPR007834
InterPro abstract:

This family includes yeast Sem1 and its mammalian homologue, DSS1.

Sem1/DSS1 (also known as rpn15) is a component of lid subcomplex of 26S proteasome regulatory subunit [ PUBMED:23643786 PUBMED:24412063 PUBMED:15117943 expand

GO process:proteasome assembly (GO:0043248), mRNA export from nucleus (GO:0006406)
GO component:proteasome regulatory particle, lid subcomplex (GO:0008541)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 265 DSS1_SEM1 domains in 1 265 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DSS1_SEM1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DSS1_SEM1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:

Relevant references for this domain

Primary literature for the DSS1_SEM1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DSS1_SEM1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DSS1_SEM1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDSS1_SEM1
InterProIPR007834