The PTH domain within your query sequence starts at position 30 and ends at position 65, and its E-value is 7.55e-20.

KRAVSEIQLMHNLGKHLASMERMQWLRRKLQDMHNF
PTH

PTH

Parathyroid hormone
SMART ACC:SM000087
Description: -
InterPro ACC:IPR001415
InterPro abstract:

Parathyroid hormone (PTH) is a polypeptidic hormone that elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Parathyroid hormone-related protein (PTH-rP) is structurally related to PTH [ PUBMED:2682846 ] and seems to play a physiological role in lactation, possibly as a hormone … expand

GO component:extracellular region (GO:0005576)
GO function:hormone activity (GO:0005179)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 346 PTH domains in 345 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PTH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PTH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PTH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PTH domain which could be assigned to a KEGG orthologous group, and not all proteins containing PTH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001415