The 14_3_3 domain within your query sequence starts at position 5 and ends at position 244, and its E-value is 7.42e-142.

KSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEG
14_3_3

14_3_3

14-3-3 homologues
SMART ACC:SM000101
Description:14-3-3 homologues mediates signal transduction by binding to phosphoserine-containing proteins. They are involved in growth factor signalling and also interact with MEK kinases.
InterPro ACC:IPR023410
InterPro abstract:

This entry represents the structural domain found in 14-3-3 proteins.

The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimers within all eukaryotic cells [ PUBMED:1671102 PUBMED:11911880 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 285 14_3_3 domains in 6 269 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing 14_3_3 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing 14_3_3 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Phosphoserine-binding; homodimer formation

Relevant references for this domain

Primary literature for the 14_3_3 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a 14_3_3 domain which could be assigned to a KEGG orthologous group, and not all proteins containing 14_3_3 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfam14-3-3
InterProIPR023410