The DUF1041 domain within your query sequence starts at position 836 and ends at position 941, and its E-value is 3.88e-55.

KTVIRKCLEQAALVNYSRLSEYAKIEENQKDAENVGRLITPAKKLEDTIRLAELVIEVLQQNEEHHAEPHVDKGEAFAWWSDLMVEHAETFLSLFAVDMDAALEVQ
DUF1041

DUF1041

Domain of Unknown Function (DUF1041)
SMART ACC:SM001145
Description:This family consists of several eukaryotic domains of unknown function. Members of this family are often found in tandem repeats and co-occur with C1,C2 and PH (SM00109, SM00239, SM00233) domains.
InterPro ACC:IPR010439
InterPro abstract:

This entry corresponds to the MUN domain [ PUBMED:28177287 ] found in Munc13 proteins. These constitute a family of three highly homologous molecules (Munc13-1, Munc13-2 and Munc13-3) with homology to Caenorhabditis elegans unc-13p. Munc13 proteins contain a phorbol ester-binding C1 domain and two C2 domains, which are … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 859 DUF1041 domains in 3 851 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF1041 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF1041 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF1041 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF1041 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF1041
InterProIPR010439