The DEXDc domain within your query sequence starts at position 267 and ends at position 520, and its E-value is 4.21e-20.

LARAVKPHQIGGIRFLYDNLVESLERFKTSSGFGCILAHSMGLGKTLQVISFIDVLFRHTPAKTVLAIVPVNTLQNWLAEFNMWLPAPEALPADSKPEEVQPRFFKVHILNDEHKTVASRAKVTADWVSEGGVLLMGYEMYRLLTLKKSLATSRPKKTKKRSHPVIIDLDEEDRQQEFRREFEKALCRPGPDVVICDEGHRIKNCQASTSQALKNIRSRRRVVLTGYPLQNNLIEYWCMVDFVRPDFLGTRQEF
DEXDc

DEXDc

DEAD-like helicases superfamily
SMART ACC:SM000487
Description: -
InterPro ACC:IPR014001
InterPro abstract:

This entry represents the DNA-binding domain of classical SF1 and SF2 helicases. It does not recognise bacterial DinG and eukaryotic Rad3 which differ from other SF1-SF2 helicases by the presence of a large insert after the Walker A (see IPR014013 ).

Helicases have been classified in 5 superfamilies … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 499 956 DEXDc domains in 496 764 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DEXDc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DEXDc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the DEXDc domain.

ProteinDescriptionDisease / phenotype
BLM_HUMANOMIM:210900 : Bloom syndrome
OMIM:604610 : Bloom syndrome
OMIM:210900 : no description
ERCC6_HUMANOMIM:133540 : Cockayne syndrome-2, type B ; Cerebrooculofacioskeletal syndrome
OMIM:214150 : no description
ATRX_HUMANOMIM:300032 : Alpha-thalassemia/mental retardation syndrome
OMIM:301040 : Juberg-Marsidi syndrome
OMIM:309590 : Sutherland-Haan syndrome
OMIM:309470 : Smith-Fineman-Myers syndrome
OMIM:309580 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DEXDc domain which could be assigned to a KEGG orthologous group, and not all proteins containing DEXDc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITE DEAH_ATP_HELICASE
InterProIPR014001
PfamSNF2_N