The COLFI domain within your query sequence starts at position 1459 and ends at position 1654, and its E-value is 4.42e-117.

LEEIFGSLDSLREEIEQMRRPAGTQDSPARTCQDLKLCHPELPDGEYWVDPNQGCARDAFRVFCNFTAGGETCVTPRDDVTQFSYVDSEGSPVGVVQLTFLRLLSVSAHQDVSYPCSGVSQDGPLKLRGANEDELSPETSPYVKEFRDGCQTQQGRTVLEVRTPVLEQLPVLDASFADLGAPTRRGGVLLGPVCFM
COLFI

COLFI

Fibrillar collagens C-terminal domain
SMART ACC:SM000038
Description:Found at C-termini of fibrillar collagens: Ephydatia muelleri procollagen EMF1alpha, vertebrate collagens alpha(1)III, alpha(1)II, alpha(2)V etc.
InterPro ACC:IPR000885
InterPro abstract:

This entry represents the C-terminal non-collagenous domain of animal fibrillar collagens, also named C-propeptide, which is highly conserved from invertebrates to vertebrates (types I-III, V, XI, XXIV and XXVII) [ PUBMED:9210465 PUBMED:10936452 expand

GO function:extracellular matrix structural constituent (GO:0005201)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 907 COLFI domains in 5 904 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing COLFI domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing COLFI domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the COLFI domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the COLFI domain.

ProteinDescriptionDisease / phenotype
CO1A2_HUMANOMIM:120160 : Osteogenesis imperfecta, 3 clinical forms
OMIM:166200 : no description
OMIM:166210 : no description
OMIM:259420 : Ehlers-Danlos syndrome, type VIIA2
OMIM:130060 : Osteoporosis, idiopathic
OMIM:166710 : Marfan syndrome, atypical
CO1A1_HUMANOMIM:120150 : Osteogenesis imperfecta, 4 clinical forms
OMIM:166200 : no description
OMIM:166210 : no description
OMIM:259420 : no description
OMIM:166220 : Ehlers-Danlos syndrome, types I and VIIA
OMIM:130000 : no description
OMIM:130060 : Osteoporosis, idiopathic
OMIM:166710 : no description
CO5A1_HUMANOMIM:120215 : Ehlers-Danlos syndrome, type II
OMIM:130010 : Ehlers-Danlos syndrome, type I
OMIM:130000 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a COLFI domain which could be assigned to a KEGG orthologous group, and not all proteins containing COLFI domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000885