The Lig_chan-Glu_bd domain within your query sequence starts at position 459 and ends at position 522, and its E-value is 6.6e-20.

LFTALENGSVPRTLRRCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLA
Lig_chan-Glu_bd

Lig_chan-Glu_bd

Ligated ion channel L-glutamate- and glycine-binding site
SMART ACC:SM000918
Description:This region, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and it binds L-glutamate and glycine. It is found in association with Lig_chan.
InterPro ACC:IPR019594
InterPro abstract:

This region, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine in the ionotropic glutamate receptor NMDA [ PUBMED:10465381 PUBMED:8428958 expand

GO component:membrane (GO:0016020)
GO function:ligand-gated monoatomic ion channel activity (GO:0015276)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 12 153 Lig_chan-Glu_bd domains in 11 972 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Lig_chan-Glu_bd domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Lig_chan-Glu_bd domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Lig_chan-Glu_bd domain which could be assigned to a KEGG orthologous group, and not all proteins containing Lig_chan-Glu_bd domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamLig_chan-Glu_bd
InterProIPR019594