The PIG-X domain within your query sequence starts at position 49 and ends at position 249, and its E-value is 3.24e-19.

LKDGFHRDLLIKVKFGESIEDLQTCRLLIKHYIPPGLFVDPYELASLRERNLTEAVMLSESFNIEAPNYLSNESAVLIYARQDAQCIDCFQAFLPVHYRYHRPHKKDGDTLIVVNNPDLLMYCDQEFPILKCWAQSEVAAPCALKSEEICQWKSMQYKSILKNLTVQVPVGLTIHTSLVCSVTLLITILCSTLILLAVFKY
PIG-X

PIG-X

PIG-X / PBN1
SMART ACC:SM000780
Description:Mammalian PIG-X and yeast PBN1 are essential components of glycosylphosphatidylinositol-mannosyltransferase I. These enzymes are involved in the transfer of sugar molecules.
InterPro ACC:IPR013233
InterPro abstract:

Mammalian PIG-X and yeast PBN1 are essential components of glycosylphosphatidylinositol-mannosyltransferase I [ PUBMED:15635094 ]. These enzymes are involved in the transfer of sugar molecules. They probably act by stabilizing the mannosyltransferase PIG-M (GPI14 in yeast) [ PUBMED:15635094 expand

GO process:GPI anchor biosynthetic process (GO:0006506)
GO component:endoplasmic reticulum membrane (GO:0005789)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 054 PIG-X domains in 1 054 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PIG-X domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PIG-X domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PIG-X domain which could be assigned to a KEGG orthologous group, and not all proteins containing PIG-X domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR013233
PfamPIG-X