The BSD domain within your query sequence starts at position 99 and ends at position 154, and its E-value is 8.89e-11.

LLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDS
BSD

BSD

domain in transcription factors and synapse-associated proteins
SMART ACC:SM000751
Description:
InterPro ACC:IPR005607
InterPro abstract:

The BSD domain is an about 60-residue long domain named after the BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins in which it is found. Additionally, it is also found in several hypothetical proteins. The BSD domain occurs in one or two copies in a variety of species ranging from primal protozoan to human. It can be found associated with other domains such … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 814 BSD domains in 4 467 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BSD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BSD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the BSD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BSD domain which could be assigned to a KEGG orthologous group, and not all proteins containing BSD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005607