The DNaseIc domain within your query sequence starts at position 6 and ends at position 200, and its E-value is 6.86e-67.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 86230916 ) for details.

LMGTLLTLVNLLQLAGTLRIAAFNIRTFGETKMSNATLSVYFVKILSRYDIAVIQEVRDSHLVAVGKLLDELNRDKPDTYRYVVSEPLGRKSYKEQYLFVYRPDQVSILDSYQYDDGCEPCGNDTFSREPAIVKFFSPYTEVQEFAIVPLHAAPTEAACLLVGHHVHGRLQCWLQLRHFLPVVLHSPSDKPHLPV
DNaseIc

DNaseIc

deoxyribonuclease I
SMART ACC:SM000476
Description:Deoxyribonuclease I catalyzes the endonucleolytic cleavage of double-stranded DNA. The enzyme is secreted outside the cell and also involved in apoptosis in the nucleus.
InterPro ACC:IPR016202
InterPro abstract:

This entry represents DNaseI and related proteins such as DNase gamma.

Deoxyribonuclease I (DNase I) ( EC:3.1.21.1 ) [ PUBMED:3713845 ] is a vertebrate enzyme which catalyzes the endonucleolytic cleavage of double-stranded DNA to 5'- phosphodinucleotide … expand

GO process:DNA catabolic process (GO:0006308)
GO function:DNA nuclease activity (GO:0004536)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 251 DNaseIc domains in 2 223 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DNaseIc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DNaseIc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DNaseIc domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the DNaseIc domain.

ProteinDescriptionDisease / phenotype
DNAS1_HUMANOMIM:125505 : DEOXYRIBONUCLEASE I; DNASE1

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DNaseIc domain which could be assigned to a KEGG orthologous group, and not all proteins containing DNaseIc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR016202
PROSITEDNASE_I_1