The PTX domain within your query sequence starts at position 175 and ends at position 381, and its E-value is 5.82e-89.

LPAGCETAIFFPMRSKKIFGSVHPVRPMKLESFSTCIWVKATDVLNKTILFSYGTKWNPYEIQLYLSSQSLVLVVGGKENKLAADTVVSLGRWSHLCGTWSSEQGSMSLWANGELVATTVEMAKSHSVPEGGLLQIGQEKNGCCVGGGFDESLAFSGRITGFNIWDRVLSEEEIRASGGVESCHIRGNVVGWGVTEIQAHGGAQYVS
PTX

PTX

Pentraxin / C-reactive protein / pentaxin family
SMART ACC:SM000159
Description:This family form a doscoid pentameric structure. Human serum amyloid P demonstrates calcium-mediated ligand-binding.
InterPro ACC:IPR001759
InterPro abstract:

This entry represents Pentaxins and its related proteins such as CRP (C-reactive protein) and SAP (serum amyloid P component protein) [ PUBMED:9480764 ]. This entry also includes adhesion G-protein coupled receptors D2 and G6 from humans.

Pentraxins (or pentaxins) [ PUBMED:6356809 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 293 PTX domains in 1 204 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PTX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PTX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PTX domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PTX domain which could be assigned to a KEGG orthologous group, and not all proteins containing PTX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPTX_DOMAIN
InterProIPR001759
Pfampentaxin