The SapB domain within your query sequence starts at position 58 and ends at position 135, and its E-value is 1.87e-27.

LPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSASCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLC
SapB

SapB

Saposin (B) Domains
SMART ACC:SM000741
Description:Present in multiple copies in prosaposin and in pulmonary surfactant-associated protein B. In plant aspartic proteinases, a saposin domain is circularly permuted. This causes the prediction algorithm to predict two such domains, where only one is truly present.
InterPro ACC:IPR008139
InterPro abstract:

The saposin B-type domain is a ~80 amino acid domain present in saposins andrelated proteins that interact with lipids. The domain is named after thesmall lysosomal proteins, saposins, which serve as sphingolipid hydrolaseactivator proteins in vertebrates. The mammalian saposins are synthesized as asingle precursor molecule (prosaposin) which contains two saposin A-typedomains in the extremities … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 10 812 SapB domains in 5 432 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SapB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SapB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)
Binding / catalysis:Forms pores, binds lipids

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SapB domain which could be assigned to a KEGG orthologous group, and not all proteins containing SapB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR008139