The CDT1 domain within your query sequence starts at position 199 and ends at position 362, and its E-value is 3.68e-91.

LPYKYQVLVEMFRSMDTIVSMLHNRSETVTFAKVKQGVQEMMRKRFEERNVGQIKTVYPTSYRFRQECNVPTFKDSIKRSDYQLTIEPLLGQEAGGATQLTATCLLQRRQVFRQNLVERVKEQHKVFLASLNPPMAVPDDQLTRWHPRFNVDEVPDIEPAELPQ
CDT1

CDT1

DNA replication factor CDT1 like
SMART ACC:SM001075
Description:CDT1 is a component of the replication licensing system and promotes the loading of the mini-chromosome maintenance complex onto chromatin. Geminin is an inhibitor of CDT1 and prevents inappropriate re-initiation of replication on an already fired origin. This region of CDT1 binds to Geminin (PUBMED:15286659).
InterPro ACC:IPR014939
InterPro abstract:

This entry represents the geminin-binding domain of the DNA replication factor CDT1 and related domains whose functions are not known [ PUBMED:15286659 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 576 CDT1 domains in 1 573 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CDT1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CDT1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport
Binding / catalysis:Binds to Geminin

Relevant references for this domain

Primary literature for the CDT1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CDT1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing CDT1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamCDT1
InterProIPR014939