The Hr1 domain within your query sequence starts at position 221 and ends at position 289, and its E-value is 7.79e-25.

LRIEELRHHFRVEHAVAEGAKNVLRLLSGAKAPDRKAVSEAQEKLTESNQKLGLLRESLERRLGELPAD
Hr1

Hr1

Rho effector or protein kinase C-related kinase homology region 1 homologues
SMART ACC:SM000742
Description:Alpha-helical domain found in vertebrate PRK1 and yeast PKC1 protein kinases C. The HR1 in rhophilin bind RhoGTP; those in PRK1 bind RhoA and RhoB. Also called RBD - Rho-binding domain
InterPro ACC:IPR011072
InterPro abstract:

This entry also includes Transducer of Cdc42-dependent actin assembly protein (TOCA) family proteins which contains a central HR1 (also known as Rho effector motif class 1, REM-1) which is closely related to Cdc42-interacting protein 4 (CIP4), effectors of the Rho family small G protein Cdc2 [ PUBMED:27129201 ].

expand
GO process:signal transduction (GO:0007165)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 745 Hr1 domains in 3 157 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Hr1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Hr1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:RhoGTP-binding

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Hr1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Hr1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR011072
PfamHR1