The G_gamma domain within your query sequence starts at position 9 and ends at position 74, and its E-value is 6.3e-23.

LTEKDKLKMEVDQLKKEVTLERMMVSKCCEEVRDYIEERSGEDPLVKGIPEDKNPFKELKGGCVIS
G_gamma

G_gamma

GGL domain
SMART ACC:SM001224
Description:G-protein gamma like domains (GGL) are found in the gamma subunit of the heterotrimeric G protein complex and in regulators of G protein signaling (RGS) proteins (PUBMED:9789084). It is also found fused to an inactive Galpha in the Dictyostelium protein gbqA (PUBMED:21182906). G-gamma likely shares a common origin with the helical N-terminal unit of G-beta (PUBMED:21182906). All organisms that posses a G-beta possess a G-gamma (PUBMED:21182906).
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 344 G_gamma domains in 6 337 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing G_gamma domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing G_gamma domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a G_gamma domain which could be assigned to a KEGG orthologous group, and not all proteins containing G_gamma domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamG_gamma