The IB domain within your query sequence starts at position 35 and ends at position 111, and its E-value is 1.87e-5.

LVCLPCDESKCEEPRSCPGSIVQGVCGCCYMCARQRNESCGGAYGLHGACDRGLRCVIRPPLNGDSITEYEVGVCED
IB

IB

Insulin growth factor-binding protein homologues
SMART ACC:SM000121
Description:High affinity binding partners of insulin-like growth factors.
InterPro ACC:IPR000867
InterPro abstract:

This entry represents insulin-like growth factors (IGF-I and IGF-II), which bind with high affinity to specific binding proteins in extracellular fluids [ PUBMED:7680510 PUBMED:1725860 PUBMED:2480830 expand

GO component:extracellular region (GO:0005576)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 647 IB domains in 5 643 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the IB domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IB domain which could be assigned to a KEGG orthologous group, and not all proteins containing IB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamIGFBP
InterProIPR000867
PROSITEIB_DOMAIN