The UME domain within your query sequence starts at position 1119 and ends at position 1225, and its E-value is 2.3e-43.

MADYLQPKLLGILAFFNMQLLSSSVGIEDKKMALTSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFVRCLDHAYLGPLLSHVIVALLPLIHM
UME

UME

Domain in UVSB PI-3 kinase, MEI-41 and ESR-1
SMART ACC:SM000802
Description:Characteristic domain in UVSP PI-3 kinase, MEI-41 and ESR-1. Found in nucleolar proteins. Associated with FAT, FATC, PI3_PI4_kinase modules.
InterPro ACC:IPR012993
InterPro abstract:

This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [ PUBMED:15112237 ].

GO function:protein serine/threonine kinase activity (GO:0004674)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 292 UME domains in 1 289 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing UME domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing UME domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the UME domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a UME domain which could be assigned to a KEGG orthologous group, and not all proteins containing UME domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamUME
InterProIPR012993