The IL4_13 domain within your query sequence starts at position 1 and ends at position 131, and its E-value is 8.65e-64.

MALWVTAVLALACLGGLAAPGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
IL4_13

IL4_13

Interleukins 4 and 13
SMART ACC:SM000190
Description:Interleukins-4 and -13 are cytokines involved in inflammatory and immune responses. IL-4 stimulates B and T cells.
InterPro ACC:IPR001325
InterPro abstract:
GO process:immune response (GO:0006955)
GO component:extracellular region (GO:0005576)
GO function:cytokine receptor binding (GO:0005126)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 277 IL4_13 domains in 277 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IL4_13 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IL4_13 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the IL4_13 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IL4_13 domain which could be assigned to a KEGG orthologous group, and not all proteins containing IL4_13 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamInterleukin4
PROSITEINTERLEUKIN_4_13
InterProIPR001325