The GLA domain within your query sequence starts at position 1 and ends at position 64, and its E-value is 1.25e-25.

MAVFLEAKNAHAVLKRFPRANEFLEELRQGTIERECMEEICSYEEVKEVFENKEKTMEFWKGYP
GLA

GLA

Domain containing Gla (gamma-carboxyglutamate) residues.
SMART ACC:SM000069
Description:A hyaluronan-binding domain found in proteins associated with the extracellular matrix, cell adhesion and cell migration.
InterPro ACC:IPR000294
InterPro abstract:

The GLA (gamma-carboxyglutamic acid-rich) domain contains glutamate residues that have been post-translationally modified by vitamin K-dependent carboxylation to form gamma-carboxyglutamate (Gla) [ PUBMED:18374189 PUBMED:11818531 expand

GO component:extracellular region (GO:0005576)
GO function:calcium ion binding (GO:0005509)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 471 GLA domains in 4 427 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GLA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GLA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the GLA domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the GLA domain.

ProteinDescriptionDisease / phenotype
PROC_HUMANOMIM:176860 : Thrombophilia due to protein C deficiency ; Purpura fulminans, neonatal
FA9_HUMANOMIM:306900 : Hemophilia B ; Warfarin sensitivity

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GLA domain which could be assigned to a KEGG orthologous group, and not all proteins containing GLA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEGLA_DOMAIN
InterProIPR000294