The SF_P domain within your query sequence starts at position 1 and ends at position 193, and its E-value is 7.3e-150.

MDMSSKEVLMESPPDYSAGPRSQFRIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGLHMSQKHTEMVLEMSIGAPETQKRLAPSERADTIATFSIGSTGIVVYDYQRLLTAYKPAPGTYCYIMKMAPESIPSLEAFARKLQNFQAKPSTPTSKLGQEEGHDTGSESDSSGRDLAFLGLAVSTLCGELPLYYI
SF_P

SF_P

Pulmonary surfactant proteins
SMART ACC:SM000019
Description:Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-C, a component of surfactant, is a highly hydrophobic peptide of 35 amino acid residues which is processed from a larger precursor protein. SP-C is post-translationally modified by the covalent attachment of two palmitoyl groups on two adjacent cysteines
InterPro ACC:IPR001729
InterPro abstract:

Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-C, a component of surfactant, is a highly hydrophobic peptide of 35 amino acid residues which is processed from a larger precursor protein. SP-C is post-translationally modified by the covalent attachment of two palmitoyl groups on two … expand

GO process:respiratory gaseous exchange by respiratory system (GO:0007585)
GO component:extracellular region (GO:0005576)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 68 SF_P domains in 68 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SF_P domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SF_P domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SF_P domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the SF_P domain.

ProteinDescriptionDisease / phenotype
PSPC_HUMANOMIM:178620 : Pneumonitis, desquamative interstitial
OMIM:263000 : no description

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001729