The FerI domain within your query sequence starts at position 306 and ends at position 377, and its E-value is 5.3e-39.

MDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGV
FerI

FerI

SMART ACC:SM001202
Description:This domain is present in proteins of the Ferlin family. It is often located between two C2 domains PMID:15112237 .
InterPro ACC:IPR012968
InterPro abstract:

The ferlin gene family are characterised by multiple tandem C2 domains and a C-terminal transmembrane domain. They are found in a wide range of species and their function remains unknown, however, mutations in its two most well-characterised members, dysferlin and otoferlin, have been implicated in human disease [ PUBMED:20667140 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 316 FerI domains in 3 311 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FerI domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FerI domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FerI domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FerI domain which could be assigned to a KEGG orthologous group, and not all proteins containing FerI domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR012968
PfamFerI