The MADS domain within your query sequence starts at position 1 and ends at position 60, and its E-value is 1.1e-39.

MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
MADS

MADS

SMART ACC:SM000432
Description: -
InterPro ACC:IPR002100
InterPro abstract:

Human serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with … expand

GO function:DNA binding (GO:0003677), protein dimerization activity (GO:0046983)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 21 394 MADS domains in 21 348 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MADS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MADS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:DNA-binding

Relevant references for this domain

Primary literature for the MADS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MADS domain which could be assigned to a KEGG orthologous group, and not all proteins containing MADS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002100
PROSITEMADS_BOX_1
Pfamtranscript_fact