The RPOLCX domain within your query sequence starts at position 56 and ends at position 99, and its E-value is 6.19e-26.

MIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
RPOLCX

RPOLCX

RNA polymerase subunit CX
SMART ACC:SM000659
Description:present in RNA polymerase I, II and III
InterPro ACC:IPR006591
InterPro abstract:

This family includes the DNA-directed RNA polymerases I, II, and III subunit RPABC4 (also known as RPC10 and ABC10-alpha) [ PUBMED:10559229 ] and archaeal polymerase subunit P [ PUBMED:19419240 ].

DNA-directed RNA polymerases expand

GO process:DNA-templated transcription (GO:0006351)
GO function:DNA-directed RNA polymerase activity (GO:0003899), DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 800 RPOLCX domains in 799 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RPOLCX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RPOLCX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the RPOLCX domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RPOLCX domain which could be assigned to a KEGG orthologous group, and not all proteins containing RPOLCX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006591