The RAB domain within your query sequence starts at position 1 and ends at position 126, and its E-value is 1.21e-54.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 20221439 99216537 ) for details.

MKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQVGREQGQQLAKEYGMDFYETSACTNLNIKESFTRLTELVLQA
RAB

RAB

Rab subfamily of small GTPases
SMART ACC:SM000175
Description:Rab GTPases are implicated in vesicle trafficking.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 39 024 RAB domains in 38 982 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RAB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RAB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:GTP-hydrolysis

Relevant references for this domain

Primary literature for the RAB domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the RAB domain.

ProteinDescriptionDisease / phenotype
RASH_HUMANOMIM:190020 : Bladder cancer
OMIM:109800 : no description
RASN_HUMANOMIM:164790 : Colorectal cancer
RRAS2_HUMANOMIM:600098 : ONCOGENE TC21
A0A024RAV5_HUMANOMIM:190070 : Colorectal adenoma ; Colorectal cancer
RB27A_HUMANOMIM:603868 : Griscelli syndrome
OMIM:214450 : no description
RASK_HUMANOMIM:190070 : Colorectal adenoma ; Colorectal cancer

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RAB domain which could be assigned to a KEGG orthologous group, and not all proteins containing RAB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain