The LIF_OSM domain within your query sequence starts at position 1 and ends at position 147, and its E-value is 1.76e-93.

MNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTY
LIF_OSM

LIF_OSM

leukemia inhibitory factor
SMART ACC:SM000080
Description:OSM, Oncostatin M
InterPro ACC:IPR001581
InterPro abstract:

On the basis of functional and structural similarities, the small cytokines leukemia inhibitory factor (LIF) and oncostatin (OSM) can be classified into a single family [ PUBMED:1566332 PUBMED:1717982 ].

It has been said [ expand

GO process:immune response (GO:0006955)
GO component:extracellular region (GO:0005576)
GO function:cytokine activity (GO:0005125)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 186 LIF_OSM domains in 186 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LIF_OSM domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LIF_OSM domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LIF_OSM domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LIF_OSM domain which could be assigned to a KEGG orthologous group, and not all proteins containing LIF_OSM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001581