The BCL domain within your query sequence starts at position 46 and ends at position 144, and its E-value is 1.22e-45.

MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGW
BCL

BCL

BCL (B-Cell lymphoma); contains BH1, BH2 regions
SMART ACC:SM000337
Description:(BH1, BH2, (BH3 (one helix only)) and not BH4(one helix only)). Involved in apoptosis regulation
InterPro ACC:IPR046371
InterPro abstract:

B cell CLL/lymphoma-2 (Bcl-2) and related proteins comprise the Bcl-2 family. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes [ PUBMED:12631689 ]. Though originally characterised with … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 976 BCL domains in 4 959 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BCL domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BCL domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BCL domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the BCL domain.

ProteinDescriptionDisease / phenotype
BAX_HUMANOMIM:600040 : Colorectal cancer ; T-cell acute lymphoblastic leukemia

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BCL domain which could be assigned to a KEGG orthologous group, and not all proteins containing BCL domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEBCL2_FAMILY
InterProIPR046371
PfamBcl-2