The ELM2 domain within your query sequence starts at position 57 and ends at position 110, and its E-value is 3.89e-14.

MRVGAEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPDAKLDEYIAIAKEKH
ELM2

ELM2

SMART ACC:SM001189
Description:The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown function. It is found in the MTA1 protein that is part of the NuRD complex (PUBMED:10226007). The domain is usually found to the N terminus of a myb-like DNA binding domain SANT SM00717. ELM2 is also found associated with an ARID DNA binding domain SM01014 in Q84JT7. This suggests that ELM2 may also be involved in DNA binding, or perhaps is a protein-protein interaction domain.
InterPro ACC:IPR000949
InterPro abstract:

The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown function. It is found in the MTA1 protein that is part of the NuRD complex [ PUBMED:10226007 ]. The domain is usually found to the N terminus of a myb-like DNA binding domain and a GATA binding domain. ELM2, in some instances, is also found associated … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 103 ELM2 domains in 7 092 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ELM2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ELM2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ELM2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ELM2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing ELM2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamELM2
InterProIPR000949