The IRF-3 domain within your query sequence starts at position 223 and ends at position 407, and its E-value is 3.92e-86.

MTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLAAPNLIERQKKVKLFCLETFLSELIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFS
IRF-3

IRF-3

Interferon-regulatory factor 3
SMART ACC:SM001243
Description:This is the interferon-regulatory factor 3 chain of the hetero-dimeric structure which also contains the shorter chain CREB-binding protein. These two subunits make up the DRAF1 (double-stranded RNA-activated factor 1). Viral dsRNA produced during viral transcription or replication leads to the activation of DRAF1. The DNA-binding specificity of DRAF1 correlates with transcriptional induction of ISG (interferon-alpha,beta-stimulated gene). IRF-3 preexists in the cytoplasm of uninfected cells and translocates to the nucleus following viral infection. Translocation of IRF-3 is accompanied by an increase in serine and threonine phosphorylation, and association with the CREB coactivator occurs only after infection.
InterPro ACC:IPR019471
InterPro abstract:

This is the interferon-regulatory factor 3 chain of the hetero-dimeric structure which also contains the shorter chain CREB-binding protein. These two subunits make up the DRAF1 (double-stranded RNA-activated factor 1). Viral dsRNA produced during viral transcription or replication leads to the activation of DRAF1. The DNA-binding specificity of DRAF1 correlates with transcriptional induction … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO function:DNA-binding transcription factor activity (GO:0003700)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 955 IRF-3 domains in 2 950 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IRF-3 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IRF-3 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IRF-3 domain which could be assigned to a KEGG orthologous group, and not all proteins containing IRF-3 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR019471
PfamIRF-3