The N2227 domain within your query sequence starts at position 135 and ends at position 400, and its E-value is 2.56e-169.

NGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYKPIIKEIIKNFPKERWDPSKVNILVPGAGLGRLAWEVAMLGYACQGNEWSFFMLFSSNFVLNRCSEINKYKLYPWIHQFSNNRRSADQIRPILFPDVDPHSLPPGSNFSMTAGDFQEIYSECNAWDCIATCFFIDTAHNVIDYIDTIWRILKPGGIWINLGPLLYHFENLANELSIELSYEDIKNVVLQYGFQLEVEKESVLSTYTVNDLSMMKYYYECVLFVVRKPQ
N2227

N2227

SMART ACC:SM001296
Description:This family features sequences that are similar to a region of hypothetical yeast gene product N2227. This is thought to be expressed during meiosis and may be involved in the defence response to stressful conditions PMID:8771715.
InterPro ACC:IPR012901
InterPro abstract:

This family includes Carnosine N-methyltransferase ( EC:2.1.1.22 ), conserved from yeast to human, that catalyses the formation of anserine (beta-alanyl-N(Pi)-methyl-L-histidine) from carnosine. Anserine, a methylated derivative of carnosine (beta-alanyl-L-histidine), is an abundant constituent of vertebrate skeletal muscles. … expand

GO function:S-adenosylmethionine-dependent methyltransferase activity (GO:0008757)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 092 N2227 domains in 2 090 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing N2227 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing N2227 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the N2227 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a N2227 domain which could be assigned to a KEGG orthologous group, and not all proteins containing N2227 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR012901
PfamN2227