The PLP domain within your query sequence starts at position 163 and ends at position 223, and its E-value is 3.3e-43.

NIWSTCEVIKSPQSNGTSGVEQICVDVRQYGIIPWNAFPGKICGSALENICNTNEFYMSYH
PLP

PLP

Myelin proteolipid protein (PLP or lipophilin)
SMART ACC:SM000002
Description: -
InterPro ACC:IPR001614
InterPro abstract:

The myelin sheath is a multi-layered membrane, unique to the nervous system, that functions as an insulator to greatly increase the velocity of axonal impulse conduction [ PUBMED:2435734 ]. Myelin proteolipid protein (PLP or lipophilin) [ PUBMED:1711121 expand

GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 363 PLP domains in 1 363 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PLP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PLP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the PLP domain.

ProteinDescriptionDisease / phenotype
MYPR_HUMANOMIM:312080 : Pelizaeus-Merzbacher disease ; Spastic paraplegia-2
OMIM:312920 : no description

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPS01004
InterProIPR001614