The PLP domain within your query sequence starts at position 163 and ends at position 223, and its E-value is 3.3e-43.
NIWSTCEVIKSPQSNGTSGVEQICVDVRQYGIIPWNAFPGKICGSALENICNTNEFYMSYH
PLPMyelin proteolipid protein (PLP or lipophilin) | |
|---|---|
| SMART ACC: | SM000002 |
| Description: | - |
| InterPro ACC: | IPR001614 |
| InterPro abstract: | The myelin sheath is a multi-layered membrane, unique to the nervous system, that functions as an insulator to greatly increase the velocity of axonal impulse conduction [ PUBMED:2435734 ]. Myelin proteolipid protein (PLP or lipophilin) [ PUBMED:1711121 … expand |
| GO component: | membrane (GO:0016020) |
| Family alignment: | View the Family alignment or the Alignment consensus sequence |
| There are 1 363 PLP domains in 1 363 proteins in SMART's NRDB database. | |
Taxonomic distribution of proteins containing PLP domains
The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PLP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.
Disease genes where sequence variants are found in this domain
UniRef sequences and OMIM curated human diseases associated with missense mutations within the PLP domain.
| Protein | Description | Disease / phenotype |
|---|---|---|
| MYPR_HUMAN | OMIM:312080 : Pelizaeus-Merzbacher disease ; Spastic paraplegia-2 | |
| OMIM:312920 : no description |