The HA2 domain within your query sequence starts at position 923 and ends at position 1013, and its E-value is 3.22e-32.

NSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKMLIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYL
HA2

HA2

Helicase associated domain (HA2) Add an annotation
SMART ACC:SM000847
Description:This presumed domain is about 90 amino acid residues in length. It is found is a diverse set of RNA helicases. Its function is unknown, however it seems likely to be involved in nucleic acid binding.
InterPro ACC:IPR007502
InterPro abstract:

This is the helicase associated domain (HA2) found as a diverse set of RNA helicases. It has an all α-helical fold that can be divided in two subdomains, an N-terminal degenerated winged helix (WH) and a C-terminal ratchet-like domain [ PUBMED:26545078 PUBMED:31409651 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 38 456 HA2 domains in 38 427 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HA2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HA2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HA2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing HA2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamHA2
InterProIPR007502