The BAR domain within your query sequence starts at position 17 and ends at position 238, and its E-value is 3.92e-84.

NVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLSECLQEVYEPEWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVS
BAR

BAR

SMART ACC:SM000721
Description: -
InterPro ACC:IPR004148
InterPro abstract:

Endocytosis and intracellular transport involve several mechanistic steps:

  1. For the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton;
  2. Following its formation, the vesicle has to be pinched off the membrane;
  3. The cargo has to be subsequently transported … expand
GO component:cytoplasm (GO:0005737)
GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 786 BAR domains in 9 779 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BAR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BAR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BAR domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BAR domain which could be assigned to a KEGG orthologous group, and not all proteins containing BAR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004148
PfamBAR domain