The Med12 domain within your query sequence starts at position 101 and ends at position 172, and its E-value is 1.54e-17.

NYWLVTARSQSAIHSWFSDLAGNKPLAILAKKELPLAKSGVPQVPILSKKEDVFAYLAKYSVPMVRATWLIK
Med12

Med12

Transcription mediator complex subunit Med12
SMART ACC:SM001281
Description:Med12 is a negative regulator of the Gli3-dependent sonic hedgehog signalling pathway via its interaction with Gli3 within the RNA polymerase II transcriptional Mediator. A complex is formed between Med12, Med13, CDK8 and CycC which is responsible for suppression of transcription. This subunit forms part of the Kinase section of Mediator PMID:15175151.
InterPro ACC:IPR019035
InterPro abstract:

The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with … expand

GO process:regulation of transcription by RNA polymerase II (GO:0006357)
GO component:mediator complex (GO:0016592)
GO function:transcription coregulator activity (GO:0003712)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 905 Med12 domains in 1 902 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Med12 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Med12 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the Med12 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Med12 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Med12 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamMed12
InterProIPR019035