The SRA domain within your query sequence starts at position 411 and ends at position 582, and its E-value is 8.5e-113.

PANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTE
SRA

SRA

SET and RING finger associated domain. Domain of unknown function in SET domain containing proteins and in Deinococcus radiodurans DRA1533.
SMART ACC:SM000466
Description:Domain in SET domain containing proteins and in Deinococcus radiodurans DRA1533.
InterPro ACC:IPR003105
InterPro abstract:

This domain has been termed SRA-YDG, for SET and Ring finger Associated, and because of the conserved YDG motif within the domain. Further characteristics of the domain are the conservation of up to 13 evenly spaced glycine residues and a VRV(I/V)RG motif. The domain is mainly found in plants and animals and in bacteria. In animals, this domain is associated with the Np95-like ring finger protein … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 840 SRA domains in 1 831 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SRA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SRA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SRA domain which could be assigned to a KEGG orthologous group, and not all proteins containing SRA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003105