The DEP domain within your query sequence starts at position 405 and ends at position 479, and its E-value is 3.43e-27.

PESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGD
DEP

DEP

Domain found in Dishevelled, Egl-10, and Pleckstrin
SMART ACC:SM000049
Description:Domain of unknown function present in signalling proteins that contain PH, rasGEF, rhoGEF, rhoGAP, RGS, PDZ domains. DEP domain in Drosophila dishevelled is essential to rescue planar polarity defects and induce JNK signalling (Cell 94, 109-118).
InterPro ACC:IPR000591
InterPro abstract:

This entry represents the DEP (Dishevelled, Egl-10 and Pleckstrin) domain, a globular domain of about 80 residues that is found in over 50 proteins involved in G-protein signalling pathways. It was named after the three proteins it was initially found in:

  • Dishevelled (Dsh and Dvl), which play a key role in the transduction of the Wg/Wnt signal from the cell surface to the nucleus; … expand
GO process:intracellular signal transduction (GO:0035556)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 13 900 DEP domains in 12 135 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DEP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DEP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Unknown

Relevant references for this domain

Primary literature for the DEP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DEP domain which could be assigned to a KEGG orthologous group, and not all proteins containing DEP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000591