The CTLH domain within your query sequence starts at position 155 and ends at position 212, and its E-value is 7.82e-14.

PFLELNRILEALHEQDLGPALEWAVSHRQRLLELNSSLEFKLHRLHFIRLLAGGPEKQ
CTLH

CTLH

C-terminal to LisH motif.
SMART ACC:SM000668
Description:Alpha-helical motif of unknown function.
InterPro ACC:IPR006595
InterPro abstract:

The 33-residue LIS1 homology (LisH) motif ( IPR006594 ) is found in eukaryotic intracellular proteins involved in microtubule dynamics, cell migration, nucleokinesis and chromosome segregation. The LisH motif is likely to possess a conserved protein-binding function and it has been proposed that LisH motifs contribute … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 10 212 CTLH domains in 10 020 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CTLH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CTLH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Unknown

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CTLH domain which could be assigned to a KEGG orthologous group, and not all proteins containing CTLH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006595