The NIDO domain within your query sequence starts at position 98 and ends at position 254, and its E-value is 7.88e-77.

PFWADVHNGIRGEIYYRETMDPAILRRATKDIRKYFKDMTTFSATWVFIVTWEEVTFYGGSSTTPVNTFQAVLVSDGSYTFTLFNYYEINWTTGTASGGDPLTGLGGVMAQAGFNGGNLTNFFSLPGSRTPEIVNIQETTNVNVPGRWAFKVDGKEI
NIDO

NIDO

Extracellular domain of unknown function in nidogen (entactin) and hypothetical proteins.
SMART ACC:SM000539
Description: -
InterPro ACC:IPR003886
InterPro abstract:

The ~180-residue NIDO domain is an extracellular domain of unknown function, found in nidogen (entactin) and hypothetical proteins. The NIDO domain is found in association with other domains, such as nidogen G2 β-barrel ( IPR006605 ), thyroglobulin type-1 ( IPR000716 expand

GO process:cell-matrix adhesion (GO:0007160)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 427 NIDO domains in 3 003 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NIDO domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NIDO domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the NIDO domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NIDO domain which could be assigned to a KEGG orthologous group, and not all proteins containing NIDO domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003886