The DSRM domain within your query sequence starts at position 197 and ends at position 263, and its E-value is 5.54e-22.

PISRLAQIQQAKKEKEPEYMLLTERGLPRRREFVMQVKVGHHTAEGVGTNKKVAKRNAAENMLEILG
DSRM

DSRM

Double-stranded RNA binding motif
SMART ACC:SM000358
Description: -
InterPro ACC:IPR014720
InterPro abstract:

In contrast to other RNA-binding domains, the about 65 amino acids long dsRBD domain [ PUBMED:1438302 PUBMED:8036511 PUBMED:7972084 ] has been found in several proteins … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 49 577 DSRM domains in 36 103 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DSRM domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DSRM domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:RNA binding

Relevant references for this domain

Primary literature for the DSRM domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DSRM domain which could be assigned to a KEGG orthologous group, and not all proteins containing DSRM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR014720
Pfamdsrm