The AD domain within your query sequence starts at position 78 and ends at position 165, and its E-value is 5.73e-38.

PLASLNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEVVITPPYQVENCKGKEGSALSHVRKI
AD

AD

Anticodon-binding domain
SMART ACC:SM000995
Description:This domain of approximately 100 residues is conserved from plants to humans. It is frequently found in association with Lsm domain-containing proteins.
InterPro ACC:IPR019181
InterPro abstract:

This domain of approximately 100 residues is conserved from plants to humans. It is an anticodon-binding domain of a prolyl-tRNA synthetase [ PUBMED:11399074 ]. It is found in Lms12 and homologues. Lsm12 is a putative RNA-binding and regulation protein that might be involved in mRNA degradation or tRNA splicing [ expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 170 AD domains in 1 170 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing AD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing AD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

Relevant references for this domain

Primary literature for the AD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a AD domain which could be assigned to a KEGG orthologous group, and not all proteins containing AD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR019181
PfamAD