The MamL-1 domain within your query sequence starts at position 14 and ends at position 73, and its E-value is 1.04e-32.

PRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALHQRCIQAKAKRAGK
MamL-1

MamL-1

MamL-1 domain
SMART ACC:SM001275
Description:The MamL-1 domain is a polypeptide of up to 70 residues, numbers 15-67 of which adopt an elongated kinked helix that wraps around ANK and CSL forming one of the complexes in the build-up of the Notch transcriptional complex for recruiting general transcription factors.
InterPro ACC:IPR019082
InterPro abstract:

This entry represents the N-terminal domain found in a family of neurogenic mastermind-like proteins (MAMLs), which act as critical transcriptional co-activators for Notch signaling [ PUBMED:18758483 PUBMED:18758478 PUBMED:12370315 expand

GO process:positive regulation of transcription by RNA polymerase II (GO:0045944), Notch signaling pathway (GO:0007219)
GO component:nuclear speck (GO:0016607)
GO function:transcription coactivator activity (GO:0003713)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 672 MamL-1 domains in 671 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MamL-1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MamL-1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MamL-1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing MamL-1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamMamL-1
InterProIPR019082