The Romo1 domain within your query sequence starts at position 13 and ends at position 79, and its E-value is 1.34e-31.

PSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC
Romo1

Romo1

Reactive mitochondrial oxygen species modulator 1
SMART ACC:SM001378
Description:This is a family of small, approximately 100 amino acid, proteins found from yeasts to humans. The majority of endogenous reactive oxygen species (ROS) in cells are produced by the mitochondrial respiratory chain. An increase or imbalance in ROS alters the intracellular redox homeostasis, triggers DNA damage, and may contribute to cancer development and progression (PMID:16842742). Members of this family are mitochondrial reactive oxygen species modulator 1 (Romo1) proteins that are responsible for increasing the level of ROS in cells. Increased Romo1 expression can have a number of other effects including: inducing premature senescence of cultured human fibroblasts (PMID:18313394, 18836179) and increased resistance to 5-fluorouracil (PMID:17537404).
InterPro ACC:IPR018450
InterPro abstract:

This entry includes a group of mitochondrial proteins, including reactive oxygen species modulator 1 (Romo1) from animals and Mgr2 from fungi.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 136 Romo1 domains in 1 135 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Romo1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Romo1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Romo1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Romo1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Romo1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

PfamRomo1
InterProIPR018450