The KRAP_IP3R_bind domain within your query sequence starts at position 112 and ends at position 264, and its E-value is 2.99e-82.

PTLSRGTSFNSCYSTTGVPQSIPEWLEFWEKDPVEILLDLGFGADEPDICTQIPARFLGYSSAARGINIHVFLEAQKQRMDFENPDLYGRFQQLEILDHVTNAFSSLLDGVKTQQNQHEEKAERQAMQNPSSSGAKEHKRKMSQLLKRASRQT
KRAP_IP3R_bind

KRAP_IP3R_bind

Ki-ras-induced actin-interacting protein-IP3R-interacting domain
SMART ACC:SM001257
Description:This family includes the N-terminus of the actin-interacting protein sperm-specific antigen 2, or KRAP (Ki-ras-induced actin-interacting protein) (PUBMED:14673706). This region is found to be the residues that interact with inositol 1,4,5-trisphosphate receptor (IP3R). KRAP was first localized as a membrane-bound form with extracellular regions suggesting it might be involved in the regulation of filamentous actin and signals from the outside of the cells (PUBMED:14673706). It has now been shown to be critical for the proper subcellular localization and function of IP3R. Inositol 1,4,5-trisphosphate receptor functions as the Ca2+ release channel on specialized endoplasmic reticulum membranes, so the subcellular localisation of IP3R is crucial for its proper function (PUBMED:21501587).
InterPro ACC:IPR029325
InterPro abstract:

This domain entry includes the N terminus of the actin-interacting protein sperm-specific antigen 2 (SSFA2), also known as Ki-ras-induced actin-interacting protein (KRAP) [ PUBMED:14673706 ]. In this region are found the residues that interact with inositol 1,4,5-trisphosphate receptor (IP3R, also known as ITPR). SSFA2 … expand

GO function:signaling receptor binding (GO:0005102)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 163 KRAP_IP3R_bind domains in 1 162 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing KRAP_IP3R_bind domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing KRAP_IP3R_bind domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the KRAP_IP3R_bind domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a KRAP_IP3R_bind domain which could be assigned to a KEGG orthologous group, and not all proteins containing KRAP_IP3R_bind domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR029325
PfamKRAP_IP3R_bind