The ACTIN domain within your query sequence starts at position 30 and ends at position 399, and its E-value is 3.1e-8.

PVPLVLDNGSFQARAGWACPGPDPGPEPRLQFRAVCARGRGGARGGPGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHLGVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYRIPKVAYGIDSLFSFYHNVPKNALSSGLIISSGYQCTHILPVLEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLSRMEEILQEHSYIAEDYGAELQKWQCPDYYENNVHKMQLPFSSKLLGSTLTAEEKQERRQQQLRRLQELNARRREEKLQLDQERLERLLYVQELLEEGQMDQFHKALIELNMDSPEELQSYIQKLTLAVEQAKQKILQAEASLEVDVVDSKPEYCHNVIQ
ACTIN

ACTIN

Actin
SMART ACC:SM000268
Description:ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily
InterPro ACC:IPR004000
InterPro abstract:

Actin [ PUBMED:1388079 PUBMED:8448030 ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton. These filaments interact with myosin to produce a sliding effect, which is the basis of muscular … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 21 531 ACTIN domains in 21 481 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ACTIN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ACTIN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ACTIN domain which could be assigned to a KEGG orthologous group, and not all proteins containing ACTIN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEACTINS_2
InterProIPR004000
Pfamactin