The Biotin_carb_C domain within your query sequence starts at position 375 and ends at position 482, and its E-value is 1.21e-50.

QCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQFID
Biotin_carb_C

Biotin_carb_C

Biotin carboxylase C-terminal domain
SMART ACC:SM000878
Description:Biotin carboxylase is a component of the acetyl-CoA carboxylase multi-component enzyme which catalyses the first committed step in fatty acid synthesis in animals, plants and bacteria. Most of the active site residues reported in reference are in this C-terminal domain.
InterPro ACC:IPR005482
InterPro abstract:

Acetyl-CoA carboxylase is found in all animals, plants, and bacteria and catalyzes the first committed step in fatty acid synthesis. It is a multicomponent enzyme containing a biotin carboxylase activity, a biotin carboxyl carrier protein, and a carboxyltransferase functionality. The "B-domain" extends from the main body of the subunit where it folds into two α-helical regions and three … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 58 280 Biotin_carb_C domains in 58 272 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Biotin_carb_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Biotin_carb_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the Biotin_carb_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Biotin_carb_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Biotin_carb_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamBiotin_carb_C
InterProIPR005482